SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1LXM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1LXM1
Domain Number 1 Region: 185-326
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-22
Family First domain of FERM 0.00094
Further Details:      
 
Weak hits

Sequence:  G1LXM1
Domain Number - Region: 481-504
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0981
Family Probable GTPase Der, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1LXM1
Sequence length 710
Comment (tr|G1LXM1|G1LXM1_AILME) FERM domain containing 7 {ECO:0000313|Ensembl:ENSAMEP00000011826} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=FRMD7 OC=Ailuropoda.
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLAVGRLPCSENCTAL
MVSHILQSELGDFHEETDKKHLAQTRYLPNQDCLESKIMHFHQKHVGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGKKGRLRSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYRNVNGVHASEPVLDSRRRNSAVEVTFAAELERSKPEADPTLLHQSQSSSSFPFIYTD
PVFSTDPDPRDYFEERSPLSSFQPSCKFADNHRSTSSRLASKVSPARQLTYTDVPYIPCT
GQQVDIMPPQVFFYVDRPPQVPKRSPVMAEERERPDSCLEPTEMKPAKRSPRNVRMKSFQ
QECQELQEAMARTSGRSNINIDLEAEDPNLEDAFAYSIQEHTPKRSQSQSDMKTIRFPFG
SEFRPLGPCPTLSRKADLLTYMFAEQEFPTVLMDQGAAERYVTSESSDSESEILKPDYYS
LYGKGIRSPMARIRLSSGSLQLDEEDEGVSFNTPTAEDRTLLKPCNYFLA
Download sequence
Identical sequences G1LXM1
ENSAMEP00000011826 ENSAMEP00000011826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]