SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1M2W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1M2W0
Domain Number 1 Region: 42-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-22
Family MAM domain 0.0082
Further Details:      
 
Domain Number 2 Region: 239-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000491
Family MAM domain 0.027
Further Details:      
 
Domain Number 3 Region: 6-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1M2W0
Sequence length 351
Comment (tr|G1M2W0|G1M2W0_AILME) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000013671} KW=Complete proteome; Reference proteome OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN= OC=Ailuropoda.
Sequence
AQQGTEGFQCGNGLSLPPDNVCDFTDQCGDKSDEQQCSNYERCDFENGLCSMTQDQSLQL
GWTKRNGMTGLSLPFYDHNGDMSAHFLSLVSKVDSTSSDLRSRVFLPTNNQHTCQVTFYY
FSSQMSGKLMAGLQTSCGGPIQHLWQNTAGLQNQWERNVMNIQSNQKFQVVFQGQIISTP
EQDEVIAIDDISFSSGCLPANDEILPCPETLNMEQEPCHRDTSLCSSDSTDEGLRLYQVC
GFEFDMCDWESETSAGQISWMRAKAREVPALQSTLQQDQSSDFSGYYLWVGAKDASTLSQ
LESRAYLNSSVCRCLGKSCHLQFFYSMENSVLRVGLYNNKVRRNLDLFQIH
Download sequence
Identical sequences G1M2W0
ENSAMEP00000013671 ENSAMEP00000013671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]