SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NJ08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NJ08
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PX domain 5.36e-36
Family PX domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 239-338
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.07e-23
Family PB1 domain 0.0000223
Further Details:      
 
Domain Number 3 Region: 169-232
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-19
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NJ08
Sequence length 350
Comment (tr|G1NJ08|G1NJ08_MELGA) Neutrophil cytosolic factor 4 {ECO:0000313|Ensembl:ENSMGAP00000013282} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=NCF4 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MSLPRQLREKSDFDQLPDDVPVSANIADIEEKKGFTNYYMFVIEVKIKSGGRYLIFRRYR
EFYALHTKLEERYGGESKNSPFSCTLPVLPGKVYVGAKREIAENRIPILNIYMKNLLCLP
VWVLMDEEVRLFFYHSNFDSEQVPRRLRRLRPRTRRVKSISSQLPVLDRVATPRAEALFD
FSGTSKLELSFKKGDLIYLLSRVNKDWLEGTVNDATGIFPSAFVKIIKDLPQQEDIVNKI
RCYYYDETVSTIRDISVEEDLSSIPLFKDLMELIKQEFDQHDIVLNYRDLDGDLIRLLSD
QDVELMVSQSRKRSTEKHFFPWKLHITHKDDFSVYSTSPGIGDTQTVRTT
Download sequence
Identical sequences G1NJ08
ENSMGAP00000013282 XP_003202309.1.16129 ENSMGAP00000013282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]