SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NMW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NMW5
Domain Number 1 Region: 49-171
Classification Level Classification E-value
Superfamily Stathmin 5.1e-53
Family Stathmin 0.000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NMW5
Sequence length 172
Comment (tr|G1NMW5|G1NMW5_MELGA) Stathmin {ECO:0000256|RuleBase:RU004388} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=STMN4 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MTLAAYKEKMKELPLVSLFCSCFLSDPLNKPAYTYEADTVDLTWCVISDMEVIELNKRTS
GQSFEVILKPPSFDGIPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKVR
Download sequence
Identical sequences G1NMW5
ENSMGAP00000014955 ENSMGAP00000014955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]