SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NV80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NV80
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily DEATH domain 1.29e-36
Family DEATH effector domain, DED 0.000000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NV80
Sequence length 133
Comment (tr|G1NV80|G1NV80_MYOLU) Proliferation and apoptosis adaptor protein 15 {ECO:0000313|Ensembl:ENSMLUP00000001165} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PEA15 OC=Vespertilionidae; Myotis.
Sequence
TPVMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDK
DNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSE
EEIIKLAPPPKKA
Download sequence
Identical sequences D2I016 F7AD02 G1NV80 G1TE78 L8I4H1 W5PF85
ENSOCUP00000015190 9796.ENSECAP00000016705 9986.ENSOCUP00000015190 ENSECAP00000016705 ENSECAP00000016705 ENSOCUP00000015190 ENSMLUP00000001165 ENSAMEP00000015121 ENSOARP00000009100 ENSMLUP00000001165 ENSAMEP00000015121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]