SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PC83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PC83
Domain Number 1 Region: 628-755
Classification Level Classification E-value
Superfamily Bromodomain 8.77e-32
Family Bromodomain 0.00095
Further Details:      
 
Domain Number 2 Region: 491-619
Classification Level Classification E-value
Superfamily Bromodomain 3.4e-31
Family Bromodomain 0.0005
Further Details:      
 
Domain Number 3 Region: 199-308
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-30
Family Bromodomain 0.00072
Further Details:      
 
Domain Number 4 Region: 46-176
Classification Level Classification E-value
Superfamily Bromodomain 6.28e-30
Family Bromodomain 0.00098
Further Details:      
 
Domain Number 5 Region: 371-476
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-27
Family Bromodomain 0.00075
Further Details:      
 
Domain Number 6 Region: 1347-1416
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000602
Family HMG-box 0.0012
Further Details:      
 
Domain Number 7 Region: 802-868
Classification Level Classification E-value
Superfamily Bromodomain 0.000000000000523
Family Bromodomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PC83
Sequence length 1619
Comment (tr|G1PC83|G1PC83_MYOLU) Polybromo 1 {ECO:0000313|Ensembl:ENSMLUP00000008015} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PBRM1 OC=Vespertilionidae; Myotis.
Sequence
MRRLAFRGAGCALKKLDSMGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLP
TVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLK
MEEYDDVNLLTADFQLLFNNAKAYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDD
DEDGQDNQGTVTEGSSPSYLKEILEQLLEAIVVATNPSGHLISELFQKLPSKVQYPDYYA
IIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYM
KKAEIEHEMTKSSLRMRNKRAVQGGRLSAITMALQYGSESEEDAALAAARYEEGESEAES
ITSFMDVSNPFYQLYDTVRSCRNNQGQLIAEPFFHLPSKKKYPDYYQQIKMPISLQQIRT
KLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVMQAKKKELARRDDIED
GDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDY
PDYYKIILEPMDLKIIEHNIRNDKYAGEEGMMEDMKLMFRNARHYNEEGSQVYNDAHILE
KLLKDKRKELGPLPDDDDMASPKLKLSRKSGVSPKKSKYMTPMQQKLNEVYEAVKNYTDK
RGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNA
CTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDD
EGRCYSDSLAEIPAVDPSFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMN
RTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHNDVEKEKKEKLPKEIE
EDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVYVEPSEASLQP
HIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKC
VVMFVKEYFKLCPENFRDEDVFVCESRYSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVV
RVASVFANADKGDDEKNADNSEDSRTEDNFNLEKEKEDVPVEMANGEPGCHYFEQLRYND
MWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPEETEHEPTKMFYKKEV
FLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDVLLCESRYNESDKQMKKFKGLK
RFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSE
VIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKESSKRKINMSGYILFSSEMRA
VIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMMGGYPPGLPPLQGPVDGLVSMGSM
QPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAQGGSPYGQQVGVLGPPGQQ
APPPYPGPHPAVPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQT
LAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENL
Download sequence
Identical sequences G1PC83
ENSMLUP00000008015 ENSMLUP00000008015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]