SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PRC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PRC1
Domain Number 1 Region: 438-552
Classification Level Classification E-value
Superfamily SH2 domain 1.02e-31
Family SH2 domain 0.000000694
Further Details:      
 
Domain Number 2 Region: 120-215
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-31
Family Ras-binding domain, RBD 0.00000632
Further Details:      
 
Domain Number 3 Region: 253-366
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000104
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PRC1
Sequence length 555
Comment (tr|G1PRC1|G1PRC1_MYOLU) Growth factor receptor bound protein 7 {ECO:0000313|Ensembl:ENSMLUP00000013677} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GRB7 OC=Vespertilionidae; Myotis.
Sequence
LGPSPQDQAQGRLHSDPSSPSDAMELGLSPPHHSSSPEDLYPAPGTPPGTPPPPDTPLPG
EVKRSQPLSIPTSSRKLREEELRTTSLPSIPNPFPELCSPPSQTPITGGLSSARGLLPRD
TSCPHVVKVYSEDGACRSVEVAAGATARYVCEMLVQRAHALSDENWGLVECHPHLALERV
LEDHESVVEVQAAWPIGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDAPTGLSHE
DLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYLAD
VNESNAYVVTQGRKLYGMPTDFGFCIKPNKLRNGHKGLRIFCSEDEQSRTCWLSAFRLFK
YGVQLYKNYQQAQSRHLRPSCMGSPPLRSVSDNTLVAMDFSGHTGRIIENPQEALSVALE
EAHAWRKKTNHRFSLPTPCSSTSLSAAIHRTQPWFHGRISREDSQRLISQQGLVDGLFLV
RDSQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDEGQTRFTDLLQLVEFHQLNRG
ILPCLLRHCCTRVAL
Download sequence
Identical sequences G1PRC1
ENSMLUP00000013677 ENSMLUP00000013677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]