SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QA98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QA98
Domain Number 1 Region: 26-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-38
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 2 Region: 211-396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.6e-37
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 3 Region: 453-511
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000398
Family Fibrinogen C-terminal domain-like 0.0053
Further Details:      
 
Domain Number 4 Region: 425-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QA98
Sequence length 568
Comment (tr|G1QA98|G1QA98_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000020631} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
SLQTFAGNTNADGVMHHRLLHPVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDVADFD
GRSSLLYRFNQKLLSTLKDVISLKFKSIQGDGVLFHGEGQRGDCITLELQKGRLALRLNL
DDSKTRLSSSPPSATLGSLLDDQHWHSVLIERVGKHVNFTVDKYTQHFRTKGEADALDID
YELSFGGIPVPGKPGTFLKKNFQGCMENLYYNGINIIDLAKRRKHQIYTVGNVTFSCSEP
QIVPITFVNSSSSYLLLPGTPNIDGLSVGFQFRTWNKDGLLLSTELSEGSGALLLSLEAG
TLRLLIQKTTRRAAEILTGSNLNDGLWHSVSINARRNRITLTLDNDAASPAQDTSQIQIY
SGNSYYFGGCPDNLTAPQCLNPIEAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLHIDL
CSIKDRCLPNYCEHGGSCSQSWTTFYCNCSDTGYVGPTCHHPLYERSCEVYRHRGNTAGF
FHIDPDGSGPLGALQVYCNVTEDKIWTSVQHNNTELTRVQGASPEKPYSMALDYGGSLGQ
LEAVIDSSEHCEQEVAYYCRRSRLLNTP
Download sequence
Identical sequences G1QA98
ENSMLUP00000020631 ENSMLUP00000020631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]