SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QB82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QB82
Domain Number 1 Region: 31-65
Classification Level Classification E-value
Superfamily Defensin-like 0.000000598
Family Defensin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1QB82
Sequence length 66
Comment (tr|G1QB82|G1QB82_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000020965} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MRLLHILLLPLCLLFTQVGPGAGLLANLIPRSPKCSHQGGICYLYACPAGTKEIAMCYRA
NARCCI
Download sequence
Identical sequences G1QB82
ENSMLUP00000020965 ENSMLUP00000020965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]