SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1QPJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1QPJ5
Domain Number 1 Region: 13-336,452-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.34e-62
Family FAD-linked reductases, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.78e-30
Family L-aminoacid/polyamine oxidase 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1QPJ5
Sequence length 511
Comment (tr|G1QPJ5|G1QPJ5_NOMLE) Polyamine oxidase {ECO:0000313|Ensembl:ENSNLEP00000002861} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PAOX OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MEATGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFRHLRVLEATGRAGGRIRSERSF
GGVVEVGAHWIHGPSRDNPVFQLAAEYGLLGEKELSEENQLVETGGHVGLPSVSYASSGA
RVSLQLVAEMATLFYGLIDQTREFLHAVETPVPSVGEYLKKEIGQHVAGWTEDEETRKLK
LAILNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMASLPEDT
VVFEKPVKIIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIITVPLGFLKEHLDTFF
DPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPALRDTW
FRKLIGFVVLPSFASVHVLCGFIAGVESEFMETLSDEEVLLCLTQVLRRVTGNPRLPAPK
SVLRSRWHSAPYTRGSYSYVAVGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYS
TTHGALLSGWREADRLLGLWAPQVQQPRPRL
Download sequence
Identical sequences G1QPJ5
XP_003275536.1.23891 ENSNLEP00000002861 ENSNLEP00000002861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]