SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RCN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RCN0
Domain Number 1 Region: 288-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-51
Family SPRY domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 5.96e-19
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000102
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RCN0
Sequence length 487
Comment (tr|G1RCN0|G1RCN0_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000010979} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=TRIM50 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAWQVSLPELEDRLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAV
DGSSSPPNVSLARVIEALRLPGDPEPKVCMHHRNPLSLFCEKDQELICGLCGLLGSHQHH
PVTPVSTVYSRMKEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGIGCHTRGLVASLDMQLEQAQGTRERLVRAECVLEQFGNEDHHEF
IRKFHSMASRAELPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFQKVLPAPEPLKLDP
ATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSD
WRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHY
EQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGRLS
LEQPTKL
Download sequence
Identical sequences G1RCN0
ENSNLEP00000010979 ENSNLEP00000010979 XP_003276649.1.23891 XP_003276650.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]