SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1RTT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1RTT8
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 1.41e-30
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1RTT8
Sequence length 86
Comment (tr|G1RTT8|G1RTT8_NOMLE) Signal recognition particle 9 kDa protein {ECO:0000256|PIRNR:PIRNR017029} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=SRP9 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVK
KIEKFHSQLMRLMVAKEARNVTMETE
Download sequence
Identical sequences A0A2J8U254 G1RTT8 G2HJQ8 G3R7D5 P49458
gi|4507217|ref|NP_003124.1| 9598.ENSPTRP00000003439 9606.ENSP00000305230 9606.ENSP00000315139 ENSNLEP00000016662 ENSGGOP00000011270 NP_001233507.1.37143 NP_003124.1.87134 NP_003124.1.92137 XP_003275129.1.23891 XP_003814958.1.60992 XP_004028518.1.27298 ENSP00000305230 ENSGGOP00000011270 ENSPTRP00000003439 ENSPTRP00000003439 ENSNLEP00000016662 ENSP00000305230 ENSP00000305230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]