SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1S1U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1S1U2
Domain Number 1 Region: 744-808
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000711
Family VWC domain 0.0062
Further Details:      
 
Domain Number 2 Region: 332-390
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000314
Family VWC domain 0.011
Further Details:      
 
Domain Number 3 Region: 610-667
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000638
Family VWC domain 0.015
Further Details:      
 
Domain Number 4 Region: 251-324
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000146
Family VWC domain 0.0033
Further Details:      
 
Domain Number 5 Region: 684-743
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000199
Family VWC domain 0.0073
Further Details:      
 
Domain Number 6 Region: 497-525
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000384
Family Huristasin-like 0.0084
Further Details:      
 
Domain Number 7 Region: 466-499
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000558
Family Huristasin-like 0.003
Further Details:      
 
Domain Number 8 Region: 440-467
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000872
Family Huristasin-like 0.0067
Further Details:      
 
Weak hits

Sequence:  G1S1U2
Domain Number - Region: 537-597
Classification Level Classification E-value
Superfamily FnI-like domain 0.000126
Family VWC domain 0.0074
Further Details:      
 
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000926
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 404-432
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.003
Family Huristasin-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1S1U2
Sequence length 967
Comment (tr|G1S1U2|G1S1U2_NOMLE) Cysteine rich transmembrane BMP regulator 1 {ECO:0000313|Ensembl:ENSNLEP00000019480} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=CRIM1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
RNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENL
IAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPE
DSVLIEGYAPPGECCPLPSRCVCNPAGCLRKVCQPGNLNILVSKASGKPGECCDLYECKP
VFGVDCRTVECPPVQQTACPPDSYETQVRLTADGCCTLPTRCECLSGLCGFPMCEVGSTP
RIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFRMDNCRFCRCQGGVAICFTA
QCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDDCTFCQCVNG
ERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGKDCINGFKRD
HNGCRTCQCINSEELCSERKQGCTLDCPFGFLTDAQNCEICECRTRPKKCRPIICDKYCP
LGLLKNKHGCDICRCKKCPELSCSKICPLGFQQDSHGCLTCKCREVSASAGPPILSGTCL
TVDGHHHKNEESWHDGCRECYCLNGREMCALITCPVPACGNPTIHPGQCCPSCADDFVVQ
KPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLCQNPSRTQDS
CCPQCTDQPFRPALSRNNSVPNYCKNDEGDIFLAAESWKPDVCTSCICIDSVISCFSESC
PSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHCYCLQGQTLC
STVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVPLWPTPSEND
IIHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVAPIIICLSIIIAFLFINQKKQWIPL
LCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYSMQKQNHLQA
DNFYQTV
Download sequence
Identical sequences G1S1U2
ENSNLEP00000019480 ENSNLEP00000019480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]