SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2RB88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G2RB88
Domain Number - Region: 27-68
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0732
Family Tubulin chaperone cofactor A 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2RB88
Sequence length 153
Comment (tr|G2RB88|G2RB88_THITE) Uncharacterized protein {ECO:0000313|EMBL:AEO69059.1} KW=Complete proteome; Reference proteome OX=578455 OS=alabamense). GN=THITE_42560 OC=Thielavia.
Sequence
MADPLSVAGLATGVVSLGLQVYGGITSYLDALKCRKEDIASARQQVECLDKALQVVKTSL
PQLQQEHQAPTAAVRGCLDSCSRELKGLQTLIAELAGPDKATSGGKEKVQAFSKKLRYPF
NRPKIELLEMRLRNANSTLQLALQALGMYVLPT
Download sequence
Identical sequences G2RB88
XP_003655395.1.77082 jgi|Thite1|42560|e_gw1.3.1250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]