SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3N0Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N0Z8
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily EF-hand 3.49e-29
Family EF-hand modules in multidomain proteins 0.0045
Further Details:      
 
Domain Number 2 Region: 123-222
Classification Level Classification E-value
Superfamily EF-hand 6.39e-25
Family EF-hand modules in multidomain proteins 0.0021
Further Details:      
 
Domain Number 3 Region: 204-281
Classification Level Classification E-value
Superfamily RING/U-box 3.65e-18
Family ZZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N0Z8
Sequence length 586
Comment (tr|G3N0Z8|G3N0Z8_BOVIN) Dystrotelin {ECO:0000313|Ensembl:ENSBTAP00000055520} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DYTN OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LLPGRKEDALNSIENSTYRTAFKLRSVQTLCQLDLIGSSLIQHVLRHQSLWEAGESTLSV
QQLFQALQEMFQKVRVEKPGQMHPRASELTLSLLTTMYDSTGTGFIKLAPAAAALITLSG
DSPLTKYTALFQLYAENNRGGHDLGARMTRRVLRNLLTDLQQIPTVVGESRALCSVESAT
RSCFQGVLSPVIKEEKFLSWLQSEPPILLWIPTCYRLSATEMATHPVRCRICRNFPITGL
RYRCLKCLNFDICQACFLSSFQGESHQKSHPVVENCIQMSAKDDTRLVLRTPRNNLLQGR
CRRKEASRRQWLLDKVNPKDMASHAQARLLKKRLNRYKDKLQAIYACQEEKSCRYDTKIH
ELTINQDSLGTKLQLMGQDLQAMLQPLHRSSFSWQNVIAKGDHGRGEERFQKRGGDSSQI
KGSTEDGSQQETLPRSTVINGSHRGPAPAKHALPNSELPEATSKPRPVQSPRAQSRAQKT
SKETSSALPSSQEGRLQDIPQIPPIEMTSLALAPVERKGAMNIQEGKDELEEEELQELLS
KLTDACTLEAPSDLQSSVNLDLYCGAERVCRAFSALVDQITLTNLK
Download sequence
Identical sequences G3N0Z8
ENSBTAP00000055520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]