SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NR95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NR95
Domain Number 1 Region: 181-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000125
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  G3NR95
Domain Number - Region: 249-285
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.00706
Family Cysteine-rich DNA binding domain, (DM domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NR95
Sequence length 295
Comment (tr|G3NR95|G3NR95_GASAC) Double PHD fingers 3 {ECO:0000313|Ensembl:ENSGACP00000007862} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=DPF3 OC=Gasterosteus.
Sequence
LGDQFYKDAIEQCRSYNARLCAERSVRLPFLDSQTGVAQNNCYIWMQRHHRSPGVAAGQM
YTYPARCWRKKRRLHNATDTRLGIYGLQLGKTRHGGLMSKDPLPAQSTTLEALLRGEGLD
KRNNSKNDEESLLEIQRVLEADAAEDAFHDDDDDFEVNTPKRRHRGKGRGRGSGRRKADM
DDDKPYVCDICAKRYRNRTGLSYHYTHSHLAEEGRGGARSSAASKAPAAQQAERHKRQRG
PGGTGVPNNYCTKCQGSLKKTGKSGSPFSTCQCKVCRKHKDRSVILSTDTQPPHG
Download sequence
Identical sequences G3NR95
ENSGACP00000007862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]