SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NWE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NWE3
Domain Number 1 Region: 18-122
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 6.28e-36
Family Nucleoplasmin-like core domain 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NWE3
Sequence length 172
Comment (tr|G3NWE3|G3NWE3_GASAC) Nucleophosmin/nucleoplasmin, 3 {ECO:0000313|Ensembl:ENSGACP00000009662} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
FKDDSSSEVGLSGESKLESFLFSCELSPKVPFYTFQGDEEEDLEHFLELRTVCLGEGAKE
ETNVVEVTSMNHQGKTISVPIANLHLSCLPMVSLGEFELKAPVTIRLKAGTGPVTVSGLH
LIGNSHILLFELKRLVEDSDLSDDESEDEDDEEEISPMKPAKKKQKHVNDTV
Download sequence
Identical sequences G3NWE3
ENSGACP00000009662 ENSGACP00000009662 69293.ENSGACP00000009662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]