SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QMA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QMA0
Domain Number 1 Region: 60-81,168-245,287-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000475
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  G3QMA0
Domain Number - Region: 56-96,292-361,415-526
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0112
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QMA0
Sequence length 550
Comment (tr|G3QMA0|G3QMA0_GORGO) Oxidative stress induced growth inhibitor family member 2 {ECO:0000313|Ensembl:ENSGGOP00000003635} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=OSGIN2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVT
FPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEG
SMLTISFGSWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYRDQDDDDSQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAE
NVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADA
VLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYT
SFPEHHVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQP
ITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHLF
VERGGGDGIA
Download sequence
Identical sequences G3QMA0
ENSGGOP00000003635 ENSGGOP00000003635 XP_018888448.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]