SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QZW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QZW6
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-21
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.56e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QZW6
Sequence length 345
Comment (tr|G3QZW6|G3QZW6_GORGO) Platelet derived growth factor C {ECO:0000313|Ensembl:ENSGGOP00000008436} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PDGFC OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Download sequence
Identical sequences G3QZW6 Q9NRA1
ENSGGOP00000008436 gi|9994187|ref|NP_057289.1| ENSGGOP00000008436 ENSP00000422464 NP_057289.1.87134 NP_057289.1.92137 XP_004040602.1.27298 ENSP00000274071 ENSP00000422464 9606.ENSP00000274071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]