SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R857 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R857
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.21e-37
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 177-244
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000117
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3R857
Sequence length 295
Comment (tr|G3R857|G3R857_GORGO) Dual specificity phosphatase 15 {ECO:0000313|Ensembl:ENSGGOP00000011557} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DUSP15 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPI
KKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRP
IANPNPGFRQQLEEFGWASSRKGARHRTPKTPGAQCPPMTSATCLLAARVALLSAALVRE
ATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTEHPKEQLIM
ADVQVQLRPGSSSCTLSASTERPEGSSTPGNPDGITHLQRSCLHPKRAAYSSCTR
Download sequence
Identical sequences G3R857
ENSGGOP00000011557 XP_004062011.1.27298 ENSGGOP00000011557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]