SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3R9S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3R9S4
Domain Number 1 Region: 15-170
Classification Level Classification E-value
Superfamily EF-hand 1.68e-22
Family Calmodulin-like 0.0035
Further Details:      
 
Domain Number 2 Region: 406-468
Classification Level Classification E-value
Superfamily EF-hand 0.0000375
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3R9S4
Sequence length 629
Comment (tr|G3R9S4|G3R9S4_GORGO) EF-hand calcium binding domain 7 {ECO:0000313|Ensembl:ENSGGOP00000012168} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=EFCAB7 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MAISPRSDATFSSQKSTPSESPRTKKFPLTEEEIFYMNCRAAYLTVFKSSLENIISKDQL
YLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDDG
CILHTDLYKFLTKRGEKMTREEVNAIINLADVNADGKFDYIKFCKLYMTTNEQCLKTTLE
KLEVDSKLMRHQFGNHIEGSPERDPSPVPKPSPKITRKTDPETFSNKGDTRSSLLSATRK
FKTSVSFTVTMGANGNRNSKLTEPNLIKDWQHMQSKGCFFLEEDGEIISHQYRMQIAQRS
MVYLTIKPLNLSQVEGKPSPWLCVDTALYILKENESQANLQLVCFTELRNREVFGWTGEL
GPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGN
GLLSLEEYNFFELRTSGEKCDEDAWAVCRENFDTKMNELTRQGFMDLNLMEANDREGDPC
DLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNG
DAKVMDGYENIIVHTYSCDTWITSVIENKSDEKVIIHINNELSKNCINNRGLNIFAVEVG
PKSTMVCQHVMPLNEQQEWIYYCIYSLIS
Download sequence
Identical sequences G3R9S4
ENSGGOP00000012168 ENSGGOP00000012168 XP_004025955.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]