SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RC48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3RC48
Domain Number 1 Region: 100-149
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000484
Family Hairy Orange domain 0.0029
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000419
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RC48
Sequence length 221
Comment (tr|G3RC48|G3RC48_GORGO) Hes family bHLH transcription factor 4 {ECO:0000313|Ensembl:ENSGGOP00000013070} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HES4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
IAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTL
ILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAVLSADPAVLGKYRAGFHECLEE
VNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLP
SLGGPFPLLAPPLLPGVTRALPAAPRAGPQGPGGPWRPWLR
Download sequence
Identical sequences G3RC48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]