SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3RZM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3RZM1
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3RZM1
Sequence length 196
Comment (tr|G3RZM1|G3RZM1_GORGO) BLOC-1 related complex subunit 5 {ECO:0000313|Ensembl:ENSGGOP00000021264} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=BORCS5 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEG
ERLEPFSMKPDRELRL
Download sequence
Identical sequences G3RZM1 H2NGM6 Q969J3
9600.ENSPPYP00000004917 9606.ENSP00000321546 ENSP00000321546 ENSP00000321546 NP_477517.1.87134 NP_477517.1.92137 XP_003826597.1.60992 XP_004052794.1.27298 ENSPPYP00000004917 ENSGGOP00000021264 gi|17157999|ref|NP_477517.1| ENSP00000321546 GO.35257 HR2423 ENSGGOP00000021264 ENSPPYP00000004917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]