SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SEN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SEN9
Domain Number 1 Region: 12-109
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 5.62e-37
Family Nucleoplasmin-like core domain 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SEN9
Sequence length 215
Comment (tr|G3SEN9|G3SEN9_GORGO) Uncharacterized protein {ECO:0000313|Ensembl:ENSGGOP00000026573} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN= OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEDLMDVDMSSLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYKGSPIKVIQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDE
EEDDVKLLSISGKRSALGGSSKFPQKKVKLAADEDDDDDDDDEDDDDEDDDDDFNEEAEE
KLPVKKSIQDTPDKNAQNSVEDIKAKMQASIEKAH
Download sequence
Identical sequences G3SEN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]