SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3SPJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3SPJ0
Domain Number 1 Region: 345-470
Classification Level Classification E-value
Superfamily TIMP-like 4.45e-28
Family Tissue inhibitor of metalloproteinases, TIMP 0.072
Further Details:      
 
Domain Number 2 Region: 212-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 3 Region: 157-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000356
Family EGF-type module 0.062
Further Details:      
 
Domain Number 4 Region: 275-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3SPJ0
Sequence length 485
Comment (tr|G3SPJ0|G3SPJ0_LOXAF) Netrin 5 {ECO:0000313|Ensembl:ENSLAFP00000001628} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NTN5 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MPVTIALLFLLSQATSDPCYDPGGRPRFCLPPVTQLASVTTSCPRACAPSPGVGLGLQAS
CNGSLALALGGPFLLTSISLRFCTPGPPALVLSAAWAEGGPWRLLWRRPAWPGALGGPER
VTFRAPPGPKASVVASHLLIELGGRAGLAAASVRGRCQCHGHAARCVARSRPPRCRCRHH
TTGPGCESCRPSHRDRPWRPATPQHPHPCLPCFCNQHAWRCRFNAELFRLSGGLSGGVCE
RCRHHTTGRHCHYCQPGFWRDPSQPITSRKACRACQCHPIGATGGVCNQTSGQCSCKLGV
TGLRCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPSAYGSDPQCQNYCNASDTRVHMSL
RRYCLQDYILHVKVLAIEAAGPTWWRLAVRVLAVYKQRAQPVPRGGQDAWVPRADLACGC
LRLRPSIDYLLLGSAADGPDPARLVLDRHGLALPWRPRWARPLRRLQQEELAGGCRGLQP
PTPGP
Download sequence
Identical sequences G3SPJ0
ENSLAFP00000001628 ENSLAFP00000028963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]