SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3STL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3STL1
Domain Number 1 Region: 1637-1822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.05e-35
Family Laminin G-like module 0.0005
Further Details:      
 
Domain Number 2 Region: 1463-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-32
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 1041-1228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-23
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 1224-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-21
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 5 Region: 834-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.55e-16
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 6 Region: 142-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 7 Region: 188-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.0029
Further Details:      
 
Domain Number 8 Region: 83-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000711
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3STL1
Sequence length 1823
Comment (tr|G3STL1|G3STL1_LOXAF) Laminin subunit alpha 4 {ECO:0000313|Ensembl:ENSLAFP00000003403} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=LAMA4 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MALRSAWCSVLPLWLLWGAICSCAAASGEDNAFSFDIEGSSAVGRQEPPDTSEPRVTLGP
LPPAAEKCRAGFFRSPSGECLPCDCNSNSNECLDGSGFCLNCQQNTTGEHCEKCLDGYIG
DSIRGAPRFCQPCPCPLPHVANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLL
IGSTCRKCDCSGNSDPNMIFEDCDEVTGQCRNCLRNTTGFNCEHCAPGYYGDARIAKNCA
VCRCGGGPCDSVTGECLEENFEPPTGMDCPTISCDKCIWDLTDDLRSAALSIEESKSSLL
SVSSGAAAQRHVNEMNSTIYLLKTKLSERENQYVLRKIQINTAETTMKSLVSDVEELAEK
ENQASRKSQLIQKETVDTINHATQLVEQTHDMRDKIQEITNKMLYYGEEQELSPEEISEK
LVLAQKMLEEIRGRQPFLTQQELVDEEADEAHELLSQAENWQRLHNDTRSLFPVVLEQLD
DYNAKLSDLQESLNQALDHVRDTEDMNRATAASQRDHEKQHERVREQMEAVNTSLRASGD
SLTIPRLTLSELDDIIKNASGIYAEIDGAKKELQRKLSNLSNISHDLVQEATDHAQNLQK
DADELNRNLHSSDTNGLVQKALEASNVYENIASYVSEADETAGLALNITDRIYDAVSGID
TQIIYHKDESENLLSQARELQARADSSNTEAVADTSRRVDGALVRKSALKNRLNDAIKHL
QAAERGDAQQRLDQSKQITAEANKTMMEIQQATAPMAGNLTNWSQNLETFDSSAYNTAVD
SARDAVRNLTEVMPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFD
GHSAVEVHPKTSVDDIKAFTSLSLYIKPPVKQPELSGTEDQFILYLGSKNAKKEYMGLAI
KNDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERIGKHGKVFLTVPSLSSTAEEK
FIKKGEAGDDSLLDLDPEDTVFYVGGVPSSFKLPASLNLPGFIGCLELATLNNDVISLYN
FKHIYNMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDVEVR
TPADNGLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSTDNEKMKIPFTDIYIGGVPPEILQSRALRTHLPLDINFRG
CMKGFQFQKKDFNLLEQKETLGVGYGCPEDSLISRRAYFNGQSFIASSQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLNNGTVIMDVKGTKVQAPDKQYNDGLSHFIITSVS
PTRYELIVDKSRFGNKNLTKGKVEQTQPSEKKFYFGGSPISPQYSNFTGCISNAYFTRLD
RDVEVEDFQRYSEKVHTSLYECPIESSPLFLLHKRRKNSSKPKTNPNKKGEKSKDAPSWD
PVGLKFQERNAPRDSHCHLSSSPRAIEHAYQYGGTANSRQEFEHLKGDFGEKSQFSIRLK
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
EKSSGRLVIDGLRVLEESLPPTKASWKIKGPIYLGGVAPGRAVKNVQINSVYSFSGCLGN
LQLNGASITSASQTFSVTPCFEGPMEMGTYFSTEGGYVVLDESFNIGLKFEITFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQKLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPTA
Download sequence
Identical sequences G3STL1
ENSLAFP00000003403 ENSLAFP00000003403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]