SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3TMW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3TMW4
Domain Number - Region: 169-221
Classification Level Classification E-value
Superfamily Moesin tail domain 0.017
Family Moesin tail domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3TMW4
Sequence length 246
Comment (tr|G3TMW4|G3TMW4_LOXAF) B-cell receptor associated protein 31 {ECO:0000313|Ensembl:ENSLAFP00000016502} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=BCAP31 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MSLQWVAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIVILV
LLVIDAGREIWKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKEAGADGGKLRIGEAEVKVEEE
NKSLKADLKKLKEELANTKQKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQAAVDGP
TDKKEE
Download sequence
Identical sequences G3TMW4
ENSLAFP00000016502 XP_010599406.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]