SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3U018 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3U018
Domain Number 1 Region: 877-1150
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-68
Family Protein kinases, catalytic subunit 0.00000785
Further Details:      
 
Domain Number 2 Region: 569-854
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-48
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 425-550
Classification Level Classification E-value
Superfamily SH2 domain 5.57e-16
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 4 Region: 160-284
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000068
Family Second domain of FERM 0.0043
Further Details:      
 
Domain Number 5 Region: 369-429
Classification Level Classification E-value
Superfamily PH domain-like 0.00000112
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3U018
Sequence length 1158
Comment (tr|G3U018|G3U018_LOXAF) Tyrosine-protein kinase {ECO:0000256|PIRNR:PIRNR000636, ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=JAK1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLPDREPLRLSSGEYTAEDL
CIKAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRYGFYFTNWHG
TNDSEHSLWSLLGKSQVTELAFETRHVNLCLPLLKAESPEVVFVQGQYDLVKCLAPIRDP
KTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLT
RMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSE
NEMNRFHSNDSGNILYYEVMVTGNLGIQWRQKPNVLPVEKEKNKLKRKKLENKHKKDEEK
NKIREEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLT
ADAHHYLCTDVAPPLIVHNIENGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNIL
MTVTCFEKTEQVLGGQKQFKNFQIEVQKGHYSLHGSDRSFPTLGELMGHLKKQILRTDNI
SFVLKRCCQPKPREISNLLVATKKAQEWQPVYTMSQLSFDRILKKDIMQGEHLGRGTRTH
IYSGTLMDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGV
CVRDVENIMVEEFVEGGPLDLFMHRRSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVC
TKNLLLAREGIDSECGPFIKLSDPGIPITVLTRQECIERIPWIAPECVEDSKNLSVAADK
WSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTHCMNYDPNQRP
FFRAIMRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDP
EGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIM
EFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQ
VKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLT
YCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYHLMRKCWEFQP
SNRTTFQNLIEGFEALLK
Download sequence
Identical sequences G3U018
ENSLAFP00000003110 ENSLAFP00000021176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]