SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UCB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UCB6
Domain Number 1 Region: 12-99
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.83e-32
Family Nucleoplasmin-like core domain 0.0000203
Further Details:      
 
Weak hits

Sequence:  G3UCB6
Domain Number - Region: 149-232
Classification Level Classification E-value
Superfamily HRDC-like 0.00392
Family RNA polymerase II subunit RBP4 (RpoF) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3UCB6
Sequence length 236
Comment (tr|G3UCB6|G3UCB6_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000025474} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=NPM1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MEDSMDMDMSPLRPQNYLFGRELKADKDYHFKVDNDENEHQLSLRMVSLSAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPMVSLGGFEITPPVVSDDEDVKLLSVSGKRSAPAGG
NKVPQKKLKLEETEEKVPVKDTPAKNAQKSNQKRKDSKPSTPRSKGQESFKKQEKTPKTP
KGPSCVEYIKAKMQTSIEKGGSIPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences G3UCB6
ENSLAFP00000025474 ENSLAFP00000025474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]