SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UMT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UMT7
Domain Number 1 Region: 348-488
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-40
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 930-1080
Classification Level Classification E-value
Superfamily C-type lectin-like 7.22e-39
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 3 Region: 636-779
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-38
Family C-type lectin domain 0.000000487
Further Details:      
 
Domain Number 4 Region: 787-923
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-38
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 5 Region: 20-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.64e-35
Family Cysteine rich domain 0.000000762
Further Details:      
 
Domain Number 6 Region: 1218-1357
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-34
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 7 Region: 221-344
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-31
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 8 Region: 497-636
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-30
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1086-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-29
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 151-209
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-20
Family Fibronectin type II module 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UMT7
Sequence length 1455
Comment (tr|G3UMT7|G3UMT7_LOXAF) Mannose receptor C-type 1 {ECO:0000313|Ensembl:ENSLAFP00000029146} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=MRC1 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
LFLKVAFVFLFPVFYYETDTRQFLIYNEDHKRCVEALSPSAVQTAACNPDNESQKFRWVS
DSQVMSVAFKLCLGVPSKTDWVAITLYACDSKNEFQKWECKNDTLFGIKGEDLFFNYGNR
QEKNIMLYKGSGLWSRWKIYGTTDDLCSRSYEAMFTLLGNANGATCAFPFKFENKWYADC
TSVGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSESLWNKDPLTSIYYQINSKSALTWHQ
ARKSCQQQSAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSEGSPFRYLN
WLPGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNPFVIPSERDVPTSC
PSQWWPYAGHCYKIYRGEKKIQRNALTACRKEGGDLASIHSIEEFDFIFSQLGYESNDEL
WIGLNDIKIQMYFEWSDGTPVTFTKWLHGEPSHENNRQEDCVVMKGKDGHWADRACEQPL
DYICKMKAQTQVPAIVEVETGCRKGWKRHGFFCYLIGHTLSTFTEANQTCGNEKAYLTTV
EDRYEQAFLTSFVGLRPERYFWTGLSDIQSKGTFQWTIEEGVQFTHWNADMPGRKAGCVA
MRTGIAGGLWDVLKCDEKAKFVCKHWAEGATRPPEPTTTPEPKCPEDWGTTSKSSLCFKL
FTKGKHDKKTWFESRDFCRALGGDLASINNKEEQQAIWRLITSSSSYHELFWLGLTYGSP
SEGFTWSDGSPVSYEHWAYGEPNNYQNVEFCGELKGDPGMFWNDINCEHLNNWICQIKKG
QTPKPEPTPAPQDNPPVTEDGWVIYKEYQYYFSKEKETMDNAREFCKRNFGDLVSIQSES
EKKFLWKYVNRNDAQSAYFIGLLISLDKKFIWVDGSKVDYVAWATGEPNFANDDENCVAM
YSNSGFWNDINCGYPHAFICQRHNSSINATVLPTTPPVKGGCEQGWKSYNNKCFKIFGFV
EEERKNWQEARKACIGFGGNLVSIRNEKEQAFLTYQMTGSSFNAWIGLNDVNSEHTFLWT
DQRGVYYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSQDAGKWMDDTCDSKRGYICHTLP
NPSLPVSPTTVPSDGFINFGESSYSLIDLKLSWYEAEKYCTLHNSHIGSILDPYSNAFVW
IQMEKLNSPVWIALNSNLTNNEYVWTDKWRVRYTNWAADEPKLKSACVYLDTDGYWKTAY
CNESFYSLCKRSNDTPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTKNWGHASLEC
LRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGMWLWINKNPVSFVNWNAG
DPSGERNDCVTLLASSGFWNNVHCSSYKGYICKRPKKTVVDAEPTRTLMTTKADSRKMDP
SKPSSSVAGIVVIVILLILTGTGLAAYFFYKKRRVQLPQESTFENTLYFNSRSSPGTNDT
KDLMDNIEQNERAAI
Download sequence
Identical sequences G3UMT7
ENSLAFP00000013672 ENSLAFP00000029146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]