SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3UN16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3UN16
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily GFP-like 7.64e-57
Family Domain G2 of nidogen-1 0.0028
Further Details:      
 
Domain Number 2 Region: 214-347
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.83e-17
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 450-553
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 353-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000035
Family EGF-type module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3UN16
Sequence length 555
Comment (tr|G3UN16|G3UN16_LOXAF) Uncharacterized protein {ECO:0000313|Ensembl:ENSLAFP00000029225} KW=Complete proteome; Reference proteome OX=9785 OS=Loxodonta africana (African elephant). GN=HMCN2 OC=Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Sequence
MIGVINGQEFGEATLNTSVLQEARSGTTTIQSSISHIPANVGPLMRILIVAINPIYWALA
GENGEALNGHSLTGGSFQEESHVEFATGELLTMTQVARGLDPDGLLLLDVMVNGIIPESL
ADADLQVQDFQERYVQMGPGQLFVDSTQPFLQGGLPTFLRCNRSIQYDAARGLQPQLVQH
LQASAVSTAFDPEAEALHFQLTTALQAEENEVGCPEGFELDPQGAFCIDRDECSDGPSPC
SHFCHNAPGRFSCSCPAGFTLAWNSRDCKDVDECAWDAHLCQDGQRCVNLLGSYHCLPYC
GPGFRVAADGAGCEDVNECLEQLDECHYNQICENTPGGHRCSCPRGYRSQGPRLPCLDIN
ECLQLPRACVFQCHNLQGSYRCLCPPGQTLLPDGKACTPVVRNGQNVTTISRRGPFAPWL
QARTPIPGGSYHTWVSFRLGPVSLSSMGRAWCPPGFIRQNGICTDLDECQVRNLCQHACR
NTEGSYQCLCPAGYRLLPSGKNCQDINECEEDGVECGPSQMCFNTRGSYQCVDTPCPTTY
RQGPSPGTCFRRCSQ
Download sequence
Identical sequences G3UN16
ENSLAFP00000029225 ENSLAFP00000029225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]