SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3VPA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3VPA2
Domain Number 1 Region: 239-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-40
Family Laminin G-like module 0.00000606
Further Details:      
 
Domain Number 2 Region: 443-641
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-25
Family Laminin G-like module 0.0000578
Further Details:      
 
Domain Number 3 Region: 15-65
Classification Level Classification E-value
Superfamily GLA-domain 1.51e-19
Family GLA-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3VPA2
Sequence length 649
Comment (tr|G3VPA2|G3VPA2_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000005007} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LLKQHASQVLVRKPRANTFMEETKKGNLERECIEELCNREEAREVFENEPETNYFYPLYL
GCLGSFRVGSFVAARQSTNAYTDLRSCVNEFQGQFHDAAQSQDTDRLCGESFATGLDTLP
WQQASRQGEKLKTQGVKNTILNSWSFSEPGHPFLTVSRHALRVSERSHCCPDSASLLPPT
VCRGSSVTPPSPSPQKKWTSCFHLYKYNCVLKDCTYVDECAENICAQLCVNHPGGYSCYC
DGKKGFRLTQDQKNCETVPLCLPLNLEKNYELLYLAEQFVGIPVLYLRFRLPEITRFSAE
FDFRTYDSEGVILYAESLDHSAWFLLALRDGRIEIQFKNEHGTKVTSGGKIINDGVWNIV
SVEELENSISVKIAKEAVMNINSPGRLFKSNNGFLETKVYFAGLPRMMENGLIKLINPRL
DGCIRGWNLMNQGASEVKEIIQEKQNKHCLASVEKGSYYPGSGVAQFDIDYNNVVSAEGW
QINVTLAIRPSAGTGVMFALVSGDTVPLALSLVDSSSSEFQDVLVTIENTIVSRMEVEKL
CTHENSKVELRVSRGLLELTNSFQGETIYHEDLKTKLAILDKAMLGKIATYLGGLPDVPV
NATPVNIFYNGCMDVKINGKELDLDEAVFKQNDIRSHSCPTVLKIPNTF
Download sequence
Identical sequences G3VPA2
ENSSHAP00000005007 ENSSHAP00000005007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]