SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3W733 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3W733
Domain Number 1 Region: 164-325
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 3.66e-52
Family Functional domain of the splicing factor Prp18 0.00029
Further Details:      
 
Domain Number 2 Region: 66-121
Classification Level Classification E-value
Superfamily PRP4-like 0.0000000000000732
Family PRP4-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3W733
Sequence length 337
Comment (tr|G3W733|G3W733_SARHA) Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000011238} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN= OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
IDYLKAEISRKRQLVEDKMLLEGSKRYFKRSELARKEEEADFGRCASKIQPQEKDENQLT
SFSPVAELDPTKEKLPMNLSRQEIVSRLRGRGEPVRLFGETDYDAFQRLRKIEILMPEVN
KGLKNDLKAALDKVEQQHFQDIVAGEDTQNDLKAHEENATFEEFEALGQSLGRGDDYKDM
DIISRFLKFLLRIWTQELQAREEHVKCSVQGKLNSAAQKQTESYLRPLFRKLQNRTLPAD
LKESITEIIKFMSQREYVKANEAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSKHVAHV
LNDETQRKFIQGLKRLMTLCQKHFSAYPSKCVEYNAL
Download sequence
Identical sequences G3W733
ENSSHAP00000011238 ENSSHAP00000011238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]