SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WH22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WH22
Domain Number 1 Region: 1806-1872
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WH22
Sequence length 2537
Comment (tr|G3WH22|G3WH22_SARHA) Zinc finger FYVE-type containing 26 {ECO:0000313|Ensembl:ENSSHAP00000014727} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=ZFYVE26 OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
KMHPFGREEAASVEHLFGFFCECLKHGEWELAQACVPQLHRGQGDIPKKVENILQALVAC
PDLMRCKQHNSPQRLAWIWLLILEKWLEWDGKFPPSTLRRRIEFLLLSEDLQNNIPEDIL
KELYEAIPQDDIGPLTDSIRKKENWTPQLSTKTVSTLWDLLWQASPQAQALLDLLLGEDK
GAYGWPLQKLLIDFIQKALKSLKGLSPIPCGVADAIYGTLRILRCPGEPLGIEWHLLCGE
LLRACETEGGPLQEEQLLGCLIRKSSWSLIAIYGNIYAEQVKEKTLGSKTLGKVPSEHLD
PEKAMLTLFSNPNPTQAWKMAYFYCLSSHKHFLEQIVVTALALLKEEDFSGLSCLLDREF
RPLSQLLILLGWTHCQSLQSAKLLLQTLHRTENQECDKLLRDACDGLSAHVEVLEWCLQQ
SSLSITERDILHHLHSGGSHSVLYSLHHLTNLPALKEKDVLELLQKMLIKDPQQDQLRTD
VSVSNHLNQCQNLTLFQGFCAMKYAIYALCVNSHQRSQCQVCKEGVSENLETNQATIKDS
SSPGVSNLFSTYLAKCQHYLCSVPNFLRLELLENIFSLLLITSSDLHPDPVLPEDYAEED
DLGGKSPPDQGWSPENTQHVPQPERKPEGTVLEGLRDLPHTSPSCLIAEARAKNQELSFL
DLKHFTSGSSGFLADELAMESFLKLLQEQLEEILNSQPSEDLKLVENSSSSGSRDGLQYR
LHQLSKVLSEAQWRYKVVISNQSTEEQLTASQKCHTLATRHSSLRRAHRARKNKSDGRDR
VSSLSLESTSSELSTSTSEGSLSTMSGRSELEVQLQPQSQNALIPMMLSQPESLLASCIL
RGNFVEAHQVVFMFDLKSSPSCGELMFMECYQEVIQELAQVEHKIENTISDGVSTTVRRT
SSGRSTLQAIGSAAAAGMVFYSISDVTDKLLGISRDPIPILQEDFWISNMHIEPTAPLRD
ILEDLSPPAMAAFDLACTQCQLWKTCKQLLETAERRLHSSFESRGRKLDYVLLNSEGIRG
FPVVLQQIGKLLNYPFVPVGQIKFDNVEEKAGSHPRYSIRELLQMCLPNLTEDCVSNQTT
LYQQREQILQTLMQALQLPEPKGNLLSSLVAQASQKLPEIGAHPVQIQTHLLMKNLNSQV
PGDSGTVDYVGAFFTYSNTMASVVLRSLSSEPDHAVKVKVGNPFIILHQSPSQLMSHLLL
ERQIPPDRLASLLSQEQLGLSVPQIIISCCCEPFSLCPSRQSQQTWSLLTHLGVLAQLHT
SHYLTDIPLPSLGPTEPKEKPMLDLPSPSFSGDSPTPALTASALAFLKSHSKLLTILACL
GATLGSQVSKPSLSWKELCGRREAPLAPEQVARECEILLNEVPMLETFLTAAWEPLRGTC
EEEQSLAGGLCGHTCVSAVLLGLHSPVAMDVLKKAFEEALIARDWARALQLMDLYGQDME
ELSSIKDVVLSCATVNDKDGWQYLFSVKDAILRSKMALWLVEKWPLEPCLEILAFCISEP
AIPEELVSELHTKVKELQVYQKILDLQSTLLWPDWQTLKRCCADNPTVVMDLILEAKEYE
LCEKWGNLYPIPREHLISLNQKHLLYLLDSGDHEKALQLLQRISDPTMRLDVTERSLDQH
PGLAASHFLANYLTTHFYKELTATRHYEIQALYVGSKVLLTLPESHRASYSHLSSSPLLM
LEQLLMNMKVDWATVALQTLHHLLAGQEIGFTMEDIDALLSRYAGKALDFPYSLKEKRSD
SVIHPQEIFNQVSESETLSRSASVELSATTFPGVSFAQSSSLKERSFPHNDPLEFVPPEK
PPARQQWVPDEMEITCMVCRSERFTMFNRRHHCRRCGRLVCGSCSTKKMDVEDSRENPAR
VCDQCYNHYNKHSPEDSMGHSEASESISVESPSYLAVVRVPKAAQLEWTLDLNEEENNLV
RSEFYYEQAPSASLCIAILNLHRDPIACGHQLIDHCCRLSRGLTNPEVDAGLLTDIMKQL
LFSAKMMFVRAGQSQDLALCDSYISKVDVLNILVAAAYRHVPSLDQILHPAAVTRLRNQL
LEAEYYQLGVEVSTKTGLDLTGAWHAWGMACLKAGNLTAAREKFSRCLKPPLDLNQLTHG
SRLVQDVIEYLESTAKPILSVQDDDYFATLKELEATLRTKSLSLEMIPEGKSMHNTYYQE
CLFYLHHYSTHLAIISFYMRHNCMREALQHLQKKESPPEVFIEGIFQPSYTSGKLHILEN
LLEDIDPTLESWGKYLIAACQHLQKKNYYHLLYELQQFMKDQVRAAMTCIRFFCHKAKTY
AELGEKLTWLLKAKDHLKIYLQETSRSTGKKKLTFFRKKMNSADVSRHMNTVGLQLEVTR
FLHRCESAGTSQITALPLPTLFGNNHMKMDVACKVMLGGKNVEDGFGIAFRVLQDFKLDA
PATYCKVAQQLVKREKYSEIRQLLKCVNESGVAAKSDGDTILLSCLEKFGSIPSQELDGL
IQAIHSDDNKVLAYLMCSKLRSAYLIAVKQEYSRAMDLVRQVQQAAQSSGDKVVQEICGQ
WLLNSRTRCPHGFSSRK
Download sequence
Identical sequences G3WH22
ENSSHAP00000014727 ENSSHAP00000014727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]