SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Z1R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3Z1R0
Domain Number - Region: 77-141
Classification Level Classification E-value
Superfamily Lipocalins 0.0102
Family Fatty acid binding protein-like 0.052
Further Details:      
 
Domain Number - Region: 276-309
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0353
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3Z1R0
Sequence length 313
Comment (tr|G3Z1R0|G3Z1R0_9NEIS) Uncharacterized protein {ECO:0000313|EMBL:EGY62618.1} KW=Complete proteome OX=665946 OS=Neisseria sp. GT4A_CT1. GN=HMPREF1028_00525 OC=Neisseriaceae; Neisseria.
Sequence
MKINEYSKFRDLNYGKDDDNFENFWKKNKHTKSIFENSELFAQNYKKFNDVDECVYLVDK
SISKTLTDKIYNEKQENVICCFSSSKIIGTYGEELMWAHYANSSKGIRIDFTIDKEFEDI
YVKKVEYKPKKQFNNGAQLKEELNNNKLENIMCRKSKAWAYEKEHRAIFHKDGIPLEEGK
KLEPFIFPINIKAITFGRGCGFFPDKKPDVEAYDFKQEQKNAEKHILKIASFIYKVLKES
NKYKDSMPEFYRYEDKYSLKTIKIEENELSKEMKKIQNKSQDKIQKLSQKIVQLQKEIVD
LEKEIVNLKKAKQ
Download sequence
Identical sequences G3Z1R0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]