SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4VTN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G4VTN4
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000222
Family Chicken cartilage matrix protein 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4VTN4
Sequence length 65
Comment (tr|G4VTN4|G4VTN4_SCHMA) Uncharacterized protein {ECO:0000313|EMBL:CCD83098.1} KW=Complete proteome; Reference proteome OX=6183 OS=Schistosoma mansoni (Blood fluke). GN=Smp_077280.1 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MTVPSPCDSIPQPQFDFEEEYDQLNAQLDALSKCLDILEAKGKKVCDEAQRLIIEYRSQN
YEKSS
Download sequence
Identical sequences G4VTN4
Smp_077280.1 Smp_077280.2 XP_018655676.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]