SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4ZJJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G4ZJJ2
Domain Number - Region: 153-198
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00288
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 
Domain Number - Region: 78-148
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0628
Family Tubulin chaperone cofactor A 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4ZJJ2
Sequence length 252
Comment (tr|G4ZJJ2|G4ZJJ2_PHYSP) Uncharacterized protein {ECO:0000313|EMBL:EGZ18857.1} KW=Complete proteome; Reference proteome OX=1094619 OS=(Phytophthora megasperma f. sp. glycines). GN=PHYSODRAFT_301340 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MASMDRMKDQLRQFEVLRIEHELLRETSTEAYDRLQDYAARLERRIEGRVIDGELDGSVL
RIAQDLSELQARLKDRLTHAQKVEASNQQLREDLRAMTGGDSVDHSLRLEIHVRGERIHE
LDGLLDRVAAHLDRLQEDLQAANRRADLTAAAVERANEAASRHHDVVRDTQRHARDLEDQ
LGQLRQARAQHAREYQVLSSDSRRSQKRLTQAHARVATLGPLQSENSALREELLRRVLPG
DLHLGREPLVNI
Download sequence
Identical sequences G4ZJJ2
XP_009527915.1.77131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]