SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AMY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AMY9
Domain Number 1 Region: 4446-4572
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 7.46e-23
Family HEPN domain 0.0053
Further Details:      
 
Domain Number 2 Region: 1517-1707
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.97e-18
Family Heat shock protein 90, HSP90, N-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 109-222
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.02e-18
Family Heat shock protein 90, HSP90, N-terminal domain 0.065
Further Details:      
 
Domain Number 4 Region: 2572-2755
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.91e-17
Family Heat shock protein 90, HSP90, N-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 4301-4368
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000393
Family Chaperone J-domain 0.0000239
Further Details:      
 
Domain Number 6 Region: 224-349
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000249
Family Heat shock protein 90, HSP90, N-terminal domain 0.023
Further Details:      
 
Domain Number 7 Region: 26-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000023
Family Ubiquitin-related 0.041
Further Details:      
 
Weak hits

Sequence:  G5AMY9
Domain Number - Region: 3530-3627,3670-3688,3774-3844,3884-4067
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family GUN4-associated domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5AMY9
Sequence length 4576
Comment (tr|G5AMY9|G5AMY9_HETGA) Sacsin {ECO:0000313|EMBL:EHA98399.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15964 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSLRLNCARSIASSSCLSPGDSPGSDGRWVRVTVLPGCVGCRTLTVAASGTARDLKERIF
SEAGWPVSEQRLWRGDRELPDWIKIGDLTDKSCHLFVNLQSKGLQGGGRFGQTTPPLVDF
LKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDMAQYQGAALYVY
NNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITVFTPEDWHGIQEIARSRK
KDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQTLFGPQESGQCWNLKDDSTEI
SELSDQFAPLTGVFGSTKETFINGSFPGTVFRFPLRLQPSQLSSNLYNKQKVLELFESFR
ADADTVLLFLKSVQDVSLHVREADGTEKLLFRVTASENKALKHERPSSIKVLGTAISNYC
EKIPSSSITCVTYHVNIVLEDEGTKDAQKTSWLVCNSVGGRGISSKLDALADDLKFVPII
GIAMSLSGRDDEETGAVSDFSGKAFCFLPLPPGEESRTGLPVHISGFFGLTDNRRSIKWR
ELDQWRDPAALWNEFLIVNIVPKAYATLILDSIKRLETEKSSDFPLSVDLIYKLWPEASK
VKVHWQAGVGPVLAPLFSELFQNAVIYSFSNDWVRLEQAYFSELDESLEYTKSVLSYLQR
SGKQIAKLPGNLAAAVQLNAAASSVATPVRKVTATWVRQVLRKFAHLGSTEEKLHLLEFV
LSDQAYSELLGLELLPLQNGNFIPFSSSVSDQDVVYITSEEYPRSLFPGLEGRFILDNLK
PHLLAALKEAAQTRGRPCTQLQLLNPERFARLIKEVMNTFWPGRELIVQWYPFSEDRNHP
SVPWLKMVWKNLYIHFSEDLTLFDEMPLIPRTTLDESQTCVELIRLRIPSLVILDDETEA
QLPGFLADIVQKLGGIVLKKLDASIQHPLIKKYIHPPLPSAVLQIMEKIPLQKLCNQIAS
LLPTHKDALRKFLASLTDISEKEKRIIQELTIFKRINHSSDQGISSYTKLKGCRVLHHTA
KFPTNLRLSISVIDSSDEATIRLANMLKIEKLKTTSCLKLVLKDLENAFYSHEEVAHLML
WVLENLSSLKNENSNVLDWLMPLKFIPISQEQMVSASELFDPDIEILKDLFCNEEEMCFP
PSVFTSPDILHSLRQIGLKNEANLKEKDIVQVAKQIEALQVSSCPDQDVLKKAKTLLLVL
NKNHTLLQSSEGKMTLKKIKWVPACKERPPNYPASLVWKGDLCNLCAPPDMCDVAHAILV
GSSLPLVETIHVNVEKALGIFTKPSISAVLKHFKIVIDWYTSKTFSDEDYYQFQHILLEI
YGFMHDHLNEGKESFRGLKFPWVWTGKKFCSLAQAVIKPVHDLDLQPYLHNVPKTMAKFH
QLFKICGSIEELTSDHISMVIQKIYLKSDEDLSEQESKQNLHLMLNIIRWLYSNQIPASP
NIPVPIHHSKNPSKLIMKPIHECCYCDIKVDDLNDLLEDSVEPIILVHEDIPMKTAEWLK
VPCLSTRLINPENMGFEQSGQREPLTVRIKNILEEYPSVSDIFKELLQNADDANATECSF
MIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSDSDFVNITRLGESLKRAEVDKVGK
FGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHIKDKSNPGIKINWSKQQKRLRKFP
NQFKPFIDVFGCQLPLTVEAPYSYNGTLFRLNTCYNTADIYSLVDEFSLCGHRLIIFTQS
VNSMYLKYLKIEETDPSLAQDTIIIKKKSCSSKVLNAPILSVLKEAAKLMKTCSSSNKKL
PTDAPKASCILQITVEEFHHVFRRIADLQSPLFRGPDDDPAALFEMAKSSQSKKPSDELP
QKTLDSTTWLLCSCMDTGEALKFSLSESGRRLGLVPCGAVGVLLSETLDQKWTVKPHIGE
VFCYLPLRIKTGLPVHINGCFAVTSNRKEIWKTDTKGQWNTTFMRHVIVKAYLQALSVLR
DLTISGELTDYTYYAAWPDPDLIHDDFSVICQGFYEDIAHGKGKDLTRVFSDGSTWVSMK
NVRFLDDAILQRKDVGPAAFKIFLKYLKKTGSKNLCAVELPSSVKLGFEEAGCKQIMLEN
TFSEKQFFSEVFFPNIQEIEAGLRDPLMNFVLNEKIDEFSGILRVTPCIPCSLEGHPLVL
PSRLIHPEGRVAKLFDTKDGRFPYGSTQDYLNPIILIKLVQLGMAKDDILWDDMLERAES
VAEINKSDHLAACLRSSILLSLIDEKLKIRDPRAKDFAAKYQTIPFLPFLTKPAGFSLEW
KGNSFQPETMFAATDLYTAEYQDVVCLLQPVLNENSHSFRGCGSVSLAVKEFLGLLKKPT
VDLVINQLKEVAKSVDDGITLYQENITNACYKYLHEAMMQNELTKLSITEKLKPFSFILV
ENTYVDSEKVSFHLNFEAAPYLYQLPNKYKNNFRELFESVGVRQSFMVEDFALVLESIDQ
ERGKKQITEENFQLCRRIISEGIWNLIREKKQEFCEKNYGKILLPDTNFMLLPAKSLCYN
DCPWIKVKDTTVKYCHADIPREVAVKLGAIPKRHKALERYASNICFTTLGTEFGQKEKLT
SRIKSILNAYPSEKEMLKELLQNADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALC
VYNNQPFTEDDVRGIQNLGKGTKEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFD
PHARYAPGATSVSPGRMFRDLDADFRTQFSDVLDLYLGIHFKLDNCTMFRFPLRNEEMAK
VSEISSVPSSDRMVQNLLDKLRSDGAELLMFLNHMEKISICEIDKGTGALNVLYSVKGKI
TDGDRLKRKQFHASVIDSVTKKRQLKDIPVQQITYTMDTEDSEGNLTTWLICNRSGFSSM
DKVSKSVISAHKNQDITLFPRGGVAACITHNYKKPHRAFCFLPLSLETGLPFHVNGHFAL
DSARRNLWRDDNGVGVRSDWNNSLMTALIAPAYVELLIQLKKRYFPGSDPTLSVLQNTPT
HVVKDTLKKFLSFFPVNRLDLQPDLYCLVKALYSCIHEEMKRLLPVVRAPNIDGSDLHSA
VIITWINMSTSSKTRPFFDNLLQDELQHLKNADYNITTRKTVAENVYRLKHLLLEIGFNL
IYNCDETANLYHCLIDADIPVNYVTPADVRSFLMTFSSPDTNCMIGKLPCRLQQTNLKLF
HSLKLLVDYCFKDAEENEIEVEGLPLLITLDNVLQTFDAKRPRFLTTYHELIPSRKDLFM
NTLYLKYSNILLNCKVAKVFDISSFADLLSSVLPREYKTKNCTKWKDNFASESWLKNAWH
FISESVGIKEDQEETKPTFDVVVDTLKDWALLPGTKFTVSANQLVVPEGDVLLPLSLMHI
AVFPNAQSDKVFHALMKAGCIQLALNKICSKDNAFVPLLSCHTANIESPTSILKAVHYMV
QTSTFRTEKLVESDFEALLMYFNCNLNHLMSPDDIKILKSLPCYKSISGRYMSIAKFGTC
FVLTKSIPSAEVEKWTQSSSSAFLGEKIHLKELYEVLGCVPVDDLEVYLKHLLPKIENLS
YDAKLEHLIYLKNRLSSMEEVSEIKEQLFEKLESLLIIHDANGRLKQAKHFYDRMVRVFE
VMLPEKLFIPKDFFKKLEQLIKPKNQPAFMTSWVEFLRNIGLKYILSQQQLLQFAKEISM
RANTENWSKETLQNTVDILLHHIFQERTDLLPGNFLKELSLIPFLCPERAPAEYIRFHPQ
YQEVNGTLPLIRFNGAQVNPKFKQCDVLQLLWTSCPILPEKATPLNIKEQEGSDLGPQEQ
LEQVLNMLNVNLDPPLDKVINNCRNICSITTLDEEMVKTRAKVLRSIYEFLSAEKGEFRF
QLRGIAFVMVEDGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLGTEDIIS
TKQYVEVLSRIFKNSEGKQLDPNEMRTVKRVVSGLFKSLQNDSVKVRSDLENVRDLALYL
PSQDGRPRLLSSILEEQLDEETPKVCQFGALCSLQGRLQLLLSSEQFITGLIRIMKHEND
NAFLANEEKAIRLCKALREGLKVSCFEKLQTTLRVKGFNPIPHSRSETFAFLKRFGNAVI
LLYIQHSDSKDINFLLALAMTLKSATDNLISDTSYLIAMLGCNDIYRISEKLDSLGVKYD
SSEPSKLELPMPGTPIPAEIHYTLLMDPMNVFYPGEYVGYLVDAEGGDIYGSYQPTYTYA
IIVQEVEREDADNSSFLGKIYQIDIGYSEYKIVSSLDLYKFSRPDESSQSRDSTPSTPTS
PTEFLVSGLRSIPPLFSGREGHKTSSSKHHSAKKLKVNSLPEILKEVTSVVEQAWKLPES
ERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEISRLEKQAFLDQNADRASRRPFSTP
ASRFQSDKYSFQRFYTSWNQEATSHKSERQQQNKEKCPPSAGQPYSQRFFVPPTFKSVGN
PVEARRWLRQARANFSAARNDLHKNANEWVCFKCFLSTKLALIAADYAVRGKSDKDVKPT
ALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMEC
TACIIIKLENFIQQKV
Download sequence
Identical sequences G5AMY9
HGL_H00000371735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]