SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AWY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AWY2
Domain Number 1 Region: 23-243
Classification Level Classification E-value
Superfamily PAZ domain 1.08e-52
Family PAZ domain 0.003
Further Details:      
 
Domain Number 2 Region: 223-479
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.47e-42
Family PIWI domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AWY2
Sequence length 534
Comment (tr|G5AWY2|G5AWY2_HETGA) Piwi-like protein 3 {ECO:0000313|EMBL:EHB01543.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02131 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRVDSQNHGFLESCSVNKSLVKQDKYRSRTLKLMNFKQIGRNYYDENSKENFCDNRLEAW
RGYVTSVLPYEHSLTLCSDICHKLLRLETAYDIIMRRCEKSLQDKYIREEVSKELVGLIV
FTRYNNKTYRVDAINWDQSPRDTFKKSDGSEITFVEYYMQQYNQIITDLDQPLLVSQGRW
RKGQKNTPHEPVLLIPQLCYPTGLSDELRQKSKDMSKLTKFMQLYPWERKNELEAFINKI
RVNRTAQNELQRWSLRFDTNCLPISGRILRDVKIFQRDVSFGIGPQPADWMRESRSTPLL
TVKSLSHWVLLHPREHGNNAQSLLRSLRKVTPTMGITVGQANMYEVNEDPSSYISTLRKC
VTSHTNMVVCILPDSEKYRYDEIKKFLCIHCPVPSQCVVAETLMSGNTLLTITTKIAQQM
NCKMGGALWKVETAALDSWFRNVQQQPDSVVVYRDGVGDGQLQALLDHEIPQLVSHLRKH
HGFPSQLAQFLRDDMFIHGVGVLSEEAGDRLLEEVLVHLVHIHCDTHSTPTVPA
Download sequence
Identical sequences G5AWY2
HGL_H00000330031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]