SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BM44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BM44
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-122
Family Transglutaminase core 0.0000000083
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily E set domains 4.2e-43
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 667-764
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-24
Family Transglutaminase, two C-terminal domains 0.00074
Further Details:      
 
Domain Number 4 Region: 489-559
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000144
Family Transglutaminase, two C-terminal domains 0.0087
Further Details:      
 
Domain Number 5 Region: 617-665
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000165
Family Transglutaminase, two C-terminal domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BM44
Sequence length 769
Comment (tr|G5BM44|G5BM44_HETGA) Protein-glutamine gamma-glutamyltransferase Z {ECO:0000313|EMBL:EHB10358.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18766 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MEPVAALELRSVDLHSARNNKGHHTQEMGVERLILRRGQLFSLQLSFNRPFQAHRDHITF
VAETGPEPSELLGTRATFFLTQAQHGDVWSVSDFSADSTSLHVSLFTPASAAIGHYTLST
EIAQGQGHRVTYPLGTFILLFNPWSTEDDVYLPSETLLQEYIMKDYGFVYKGHESLVTSW
PWNYGQFEKDIIDICFEILNKSLYFFRNPAKDCSQRSDVVYVCRVVSAMINSNDDSGVLQ
GNWSEDYSRGTSPLEWNGSVAILRQWSTQGGKPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNMDGNLTIDTYYDRNAAMRPTQKRDKVWNFHVWNECWMTRKDLPPGYNGWQVL
DPTPQQASSGLFCCGPASVKAIREGDVHLAYDTPFVFAEVNADEVIWLFEDGEAQEILAH
DTSSIGKEISTKMVGSDQRQDITYSYKYPEGSPEERSVFMKASRRMLGQGRAPSPLLDLL
GSGAFRARPARLQLHLARAPVWGQDVFLTLHVRRLQDGAHPWGPLRLEIRFCAQALMHGG
STREPLWKQTVSLDLDFGKGAFGAGLRRLLQGEVSGPRNWAGLVQSGPTAPAVHTQYGQM
DSQMPTVVPLVPSCQRDSKIHWPLLLPYTSYGNKLTDEKLVRVSGLAKVEETGSSMLVLK
DFSLELPHLAIEVSMTAEVGKALRVRISLTNTLTVALSNCTMVLEGSGLIHGQIAEDLGT
LMSGDTVHMRVDLYPSKAGPRQLQVLISSSEVKEIKGYKDIFVAAAGAS
Download sequence
Identical sequences G5BM44
HGL_H00000389466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]