SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C4Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C4Y6
Domain Number 1 Region: 43-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000288
Family Hairy Orange domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C4Y6
Sequence length 328
Comment (tr|G5C4Y6|G5C4Y6_HETGA) Hairy/enhancer-of-split related with YRPW motif-like protein {ECO:0000313|EMBL:EHB16597.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09808 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKRPREQRGSDGESDGPIDLGSEGHLSQMARPLSTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRHLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPIPSSPLALPAWPWSFF
HSCPGLPALNSQLAILGRVPSPVVPSTSSLAYPIPGLRTTPMRRASGAILPARRNLLPSR
GASSIQRARPLERPAAPLPVAPSSRASRSSHLVPLLQSSSPTPLGAMGSTANVAVPVSRA
SSEAPAGRPLGAALCRSWASEITEIGAF
Download sequence
Identical sequences G5C4Y6
HGL_H00000361943 XP_004851088.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]