SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7P5H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7P5H8
Domain Number 1 Region: 137-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.01e-19
Family Thioltransferase 0.031
Further Details:      
 
Weak hits

Sequence:  G7P5H8
Domain Number - Region: 232-290
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000445
Family DnaJ/Hsp40 cysteine-rich domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7P5H8
Sequence length 290
Comment (tr|G7P5H8|G7P5H8_MACFA) Glutaredoxin domain-containing cysteine-rich protein 1 {ECO:0000313|EMBL:EHH53645.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_14324 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLKREMKPESDRPRKVRFRIASSHSGRVLKEVYEDGQPSGSLDSECASICGIDGLSDSDG
QQNGHIESEGDENENDQDSLLVLARAASEKGFGTRRVNILSKNGTVRGVKYKVSAGQALF
NNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGE
YGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDLLTKIERVQHPHECP
SCGGFGFLPCSMCHGSKMSVFRNCFTDSFKALKCTACNENGLQRCKNCVG
Download sequence
Identical sequences A0A096MTR0 A0A0D9RX12 A0A2K6A3L9 A0A2K6ALU2 F6U270 G7P5H8
9544.ENSMMUP00000035298 ENSPANP00000003201 ENSMMUP00000035298 ENSMMUP00000035298 NP_001181055.1.72884 XP_011749542.1.29376 XP_011824311.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]