SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PK23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PK23
Domain Number 1 Region: 41-121
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000589
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-155
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000471
Family Hairy Orange domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7PK23
Sequence length 156
Comment (tr|G7PK23|G7PK23_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH66158.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_03084 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPRE
Download sequence
Identical sequences G7PK23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]