SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7VCA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G7VCA6
Domain Number - Region: 115-142
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0144
Family Assembly domain of cartilage oligomeric matrix protein 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7VCA6
Sequence length 179
Comment (tr|G7VCA6|G7VCA6_9CREN) Uncharacterized protein {ECO:0000313|EMBL:AET33792.1} KW=Complete proteome OX=1104324 OS=Pyrobaculum ferrireducens. GN=P186_2406 OC=Thermoproteaceae; Pyrobaculum.
Sequence
MLETRLFNWYMCRCVAFNSVANYYPVRVTFRRDVSLPLLGVSYQANTVAEVPLYLALKLD
EMGAVEIDEAYALPPRDVASLKYVEQRETYPAKLPEGFYPRLRLTIYLLSKRGDAKTVKT
ILQDVRELLIERVKKMALLVATRPDIVNDQSFMDRLTPEEKALLMSMYNAITQFMLSVL
Download sequence
Identical sequences G7VCA6
gi|374327844|ref|YP_005086044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]