SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7VXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G7VXI6
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily Oncogene products 0.00366
Family Oncogene products 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7VXI6
Sequence length 50
Comment (tr|G7VXI6|G7VXI6_PAETH) Uncharacterized protein {ECO:0000313|EMBL:AET59428.1} KW=Complete proteome OX=985665 OS=Paenibacillus terrae (strain HPL-003). GN=HPL003_13385 OC=Paenibacillus.
Sequence
MVEIRDYLFSDNWTIYEDEECEPWIGLREQMGPREQEMIINQYEYLTKND
Download sequence
Identical sequences G7VXI6
gi|374322522|ref|YP_005075651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]