SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7XM05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7XM05
Domain Number 1 Region: 49-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000403
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.024
Further Details:      
 
Weak hits

Sequence:  G7XM05
Domain Number - Region: 155-202
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0942
Family Tubulin chaperone cofactor A 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7XM05
Sequence length 205
Comment (tr|G7XM05|G7XM05_ASPKW) 50S ribosomal protein Mrp49 {ECO:0000313|EMBL:GAA87964.1} KW=Complete proteome; Reference proteome OX=1033177 OS=awamori var. kawachi). GN=AKAW_06078 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MVNLFKRMRKLKTLLNIQVGTGAATLPTVANASKEFPAITRLHLTYARKIYGGHQGARHF
WRNCLPRLKYHNPAIPMTVRQTEEQEGPAALTIYFAERASNAASLLSAKDVTDKHAPAPG
EAEQTAVLDVKNLDYKDIWAKVKNMTGAQEIQPTPEQESELQKLEQMRQQSDKDRARIAA
IRQAKADQERMLQEARGEVEKLRQL
Download sequence
Identical sequences A0A146FA46 G7XM05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]