SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8ACS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8ACS1
Domain Number 1 Region: 3-29
Classification Level Classification E-value
Superfamily Defensin-like 0.0000114
Family Defensin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8ACS1
Sequence length 31
Comment (tr|G8ACS1|G8ACS1_PARMJ) Beta-defensin 10 {ECO:0000313|EMBL:ADE08718.1} OX=9157 OS=Parus major (Great tit). GN= OC=Coelurosauria; Aves; Neognathae; Passeriformes; Paridae; Parus.
Sequence
TVECRSQGKFCRAGACPPTFAATGTCHGGLL
Download sequence
Identical sequences G8ACS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]