SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8DG86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8DG86
Domain Number - Region: 91-178
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.000667
Family ERP29 C domain-like 0.018
Further Details:      
 
Domain Number - Region: 31-77
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.00602
Family Outer membrane lipoprotein 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8DG86
Sequence length 196
Comment (tr|G8DG86|G8DG86_9PHYC) Uncharacterized protein {ECO:0000313|EMBL:AET42780.1} OX=181211 OS=Emiliania huxleyi virus 202. GN=EXVG_00131 OC=Coccolithovirus; unclassified Coccolithovirus.
Sequence
MSSVPQSRNLKRTFADDLMDSQYRIRDENAALKKEITKLKRELNATNDAVNTWMNEAQET
EADYIEVEERMDNQYTKHVNDLLEKNKKIAEKNAIINNLMATIGTERRKTKAAKAAQQSP
EWYTKHMERTYHKYFQVLDDAGVHPMSDFAKKETVDLQKEYSNHISSKDMDDLNHRAENF
ACFTAESINNLFPGFY
Download sequence
Identical sequences G8DG86 V5LLL9 V5LPI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]