SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8IBM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8IBM6
Domain Number - Region: 44-62
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.051
Family Cysteine-rich DNA binding domain, (DM domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8IBM6
Sequence length 152
Comment (tr|G8IBM6|G8IBM6_9CAUD) Gp63 {ECO:0000313|EMBL:AER50090.1} KW=Complete proteome OX=1089127 OS=Mycobacterium phage Kikipoo. GN=KIKIPOO_63 OC=Bclasvirinae; Pg1virus.
Sequence
MLEIWDKDHLESLPDGTIIEWQRIVGDETSTAVAYVRSEVEGAETHAVACKFNECLCERV
VWISPGGWQPLTPEQAGINYPARVVRIGPGNDDRVVTPSTPPAQPPMSVRMAALDAAARV
RAADAINSRVSADLVTELADTFVTWLQGGATA
Download sequence
Identical sequences A0A222YW45 D2XS09 G1D213 G3MBZ1 G3MC90 G8I397 G8IBM6 X2KSZ7
D2XS09_9CAUD YP_009208611.1.77854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]