SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LWA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LWA7
Domain Number 1 Region: 38-297,370-428
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.72e-87
Family Type II chitinase 0.0000144
Further Details:      
 
Domain Number 2 Region: 431-492
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000608
Family Type I dockerin domain 0.001
Further Details:      
 
Domain Number 3 Region: 289-361
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000733
Family Chitinase insertion domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8LWA7
Sequence length 493
Comment (tr|G8LWA7|G8LWA7_CLOCD) Chitinase {ECO:0000313|EMBL:AEV69754.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_3239 OC=Ruminiclostridium.
Sequence
MKRNIGKAFLSLLIISAIALEVLMFLQFSTVKGQIVKQSIVYFPNWAVYLDSHNYFAVGD
IPWDKVTIVNHAFFKINDKYEIETTDRYADFEKSFPHSSGSLKGHFGEYKYYKSLYPNVK
LVVSIGGWTESGKFHEMAMTTSGRAAFINSIISFLKTYTFFDGVDIDWEYPGVTRDGCPG
GPEDRQNFTNLLKEIRQAYIDNNMPDKLLTIAVSPSKYTTSHTDPNNYAQYVDFINVMTY
DMHGEWDSITNHHSPIYAKDDYSVDGAFKLYTETYGVPANKIVIGTPFYSRGWSNVIASE
KHGLGVSGLGYLQGTLGSNGQNAYFRMKELEAMTDVYVKYWDDYARVPWLYSAALHEMYT
YEDERSLAERCDYVIDNNGGGIMVWTVAFDDKDKGFPLMSIIADKLGIGGDSVQTPTATI
MPAGTPTPASTILKGDINGDGEINSIDFAYLKKYLLGMNVPFTNILETADLNNDNSVDSI
DYALLKCLILGIK
Download sequence
Identical sequences G8LWA7
gi|374297487|ref|YP_005047678.1| WP_014256287.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]